SEARCH
ENGLISH
CAT | C1050-V |
CAS NO. | 145017-83-0 |
Product Name | ω agatoxin IVA (ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A) |
Purity | > 98% |
Form/State | Lyophilized powder |
Solubility | Soluble in water |
Molecular weight | 5202 Da |
Molecular formula | C217H360N68O60S10 |
Source | Synthetic peptide |
Storage | Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions | Up to two weeks at 4°C or three months at -20°C. |
Sequence | KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34) |
ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).
English 