Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
ω Agatoxin IVA
Products

SPECIFICATION OF ω agatoxin IVA

CAT

C1050-V

CAS NO.

145017-83-0 

Product Name

ω agatoxin IVA (ω-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A)

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

5202 Da

Molecular formula

C217H360N68O60S10

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34)




APPLICATION of ω agatoxin IVA

ω-Agatoxin (Aga) IVA, isolated from the venom of the funnel web spider Agelenopsis aperta, is a specific blocker of voltage-activated P-type calcium channels (Cav2.1).

  • APPLICATION of ω agatoxin IVA
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.