SEARCH
ENGLISH
CAT | C1060-V |
CAS NO. | 158484-42-5 |
Product Name | ω agatoxin IVB |
Purity | > 98% |
Form/State | Lyophilized powder |
Solubility | Water, or 0.9% NaCl solution |
Molecular weight | 5273 Da |
Molecular formula | C215H337N65O70S10 |
Source | Synthetic peptide |
Storage | Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions | Up to two weeks at 4°C or three months at -20°C. |
Sequence | EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, and Cys27-Cys34. D-Ser46) |
ω-agatoxin IVB antagonist of voltage-activated calcium channels was purified from the venom of the funnel-web spider, Agelenopsis aperta. This 48-amino acid peptide, omega-agatoxin (omega-Aga)-IVB, was found to be a potent blocker of P-type calcium channels
English 