Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
ω Agatoxin Ivb
Products

SPECIFICATION OF ω agatoxin IVB


CAT

C1060-V

CAS NO.

158484-42-5

Product Name

ω agatoxin IVB

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Water, or 0.9% NaCl solution

Molecular weight

5273 Da

Molecular formula

C215H337N65O70S10

Source

Synthetic peptide

Storage

Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, and Cys27-Cys34. D-Ser46)






APPLICATION of ω agatoxin IVB

ω-agatoxin IVB  antagonist of voltage-activated calcium channels was purified from the venom of the funnel-web spider, Agelenopsis aperta. This 48-amino acid peptide, omega-agatoxin (omega-Aga)-IVB, was found to be a potent  blocker of P-type calcium channels

  • APPLICATION of ω agatoxin IVB
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.