Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
APETx2
Products

SPECIFICATION OF APETx2

CAT

O1040-V

CAS NO.

713544-47-9

Product Name

APETx2

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

4561 Da

Molecular formula

C196H280N54O61S6

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)



APPLICATION of APETx2

APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.

  • APPLICATION of APETx2
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.