Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
Calcicludine
Products

SPECIFICATION OF Calcicludine


CAT

C1020-V

CAS NO.

178037-96-2 

Product Name

Calcicludine (Calcicludine, L-type Ca2+ channel blocker)

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).

Molecular weight

6979

Molecular formula

C321H476N86O78S6

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK (Disulfide bonds between Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53)


APPLICATION of Calcicludine

Calcicludine (CAC) is a 60-amino acid polypeptide from the venom of Dendroaspis angusticeps. Calcicludine, a venom peptide of the Kunitz-type protease inhibitor family, is a potent blocker of high-threshold Ca2+ channels with a high affinity for L-type channels in cerebellar granule neurons

  • APPLICATION of Calcicludine
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.