CAT | C1020-V |
CAS NO. | 178037-96-2 |
Product Name | Calcicludine (Calcicludine, L-type Ca2+ channel blocker) |
Purity | > 98% |
Form/State | Lyophilized powder |
Solubility | Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min). |
Molecular weight | 6979 |
Molecular formula | C321H476N86O78S6 |
Source | Synthetic peptide |
Storage | Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions | Up to two weeks at 4°C or three months at -20°C. |
Sequence | WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK (Disulfide bonds between Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53) |
Calcicludine (CAC) is a 60-amino acid polypeptide from the venom of Dendroaspis angusticeps. Calcicludine, a venom peptide of the Kunitz-type protease inhibitor family, is a potent blocker of high-threshold Ca2+ channels with a high affinity for L-type channels in cerebellar granule neurons