SEARCH
ENGLISH
CAT | C1010-V |
CAS NO. | 178805-91-9 |
Product Name | Calciseptine (Calciseptine, L-type Ca2+ channel blocker) |
Purity | > 98%(HPLC) |
Form/State | Lyophilized powder |
Solubility | Soluble in water |
Molecular weight | 7167.40 |
Molecular formula | C304H477N91O88S11 |
Source | Chemical synthesis |
Storage | Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions | Up to two weeks at 4°C or three months at -20°C. |
Sequence | MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK(Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59) |
Calciseptine is a natural peptide consisting of 60 amino acids with four disulfide bonds. The peptide is a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle
English 