Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
Calciseptine
Products

SPECIFICATION OF Calciseptine


CAT

C1010-V

CAS NO.

178805-91-9 

Product Name

Calciseptine (Calciseptine, L-type Ca2+ channel blocker)

Purity

> 98%(HPLC)

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

7167.40

Molecular formula

C304H477N91O88S11

Source

Chemical synthesis

Storage

Shipped at room temperature. 

The product, as supplied, can be stored intact at room temperature for several weeks. 

For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK(Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59)


Application of Calciseptine

Calciseptine is a natural peptide consisting of 60 amino acids with four disulfide bonds. The peptide is a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle

  • Application of Calciseptine
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.