CAT | K1080-V |
CAS NO. | 95751-30-7 |
Product Name | Charybdotoxin |
Purity | > 98% |
Form/State | Lyophilized powder |
Solubility | Soluble in water |
Molecular weight | 4296 Da |
Molecular formula | C176H277N57O55S7 |
Source | Synthetic peptide |
Storage | Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions | Up to two weeks at 4°C or three months at -20°C. |
Sequence | ZFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35, Z= Pyrrolidone carboxylic acid) |
Charybdotoxin (CTX), a peptide from the Leiurus scorpion venom, blocks voltage-gated K(+)-channels