Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
Charybdotoxin
Products

SPECIFICATION OF Charybdotoxin

CAT

K1080-V

CAS NO.

95751-30-7

Product Name

Charybdotoxin

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

4296 Da

Molecular formula

C176H277N57O55S7

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

ZFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35, Z= Pyrrolidone carboxylic acid)



APPLICATION of Charybdotoxin

Charybdotoxin (CTX), a peptide from the Leiurus scorpion venom, blocks voltage-gated K(+)-channels

  • APPLICATION of Charybdotoxin
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.