Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
Dendrotoxin I
Products

SPECIFICATION OF Dendrotoxin I

CAT

K1030-V

CAS NO.

107950-33-4

Product Name

Dendrotoxin-I

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

7149

Molecular formula

C312H497N99O83S6

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

QPLRKLCILHRNPGRCYQKIPAFYYNQKKKQCEGFTWSGCGGNSNRFKTIEECRRTCIRK(Disulfide bonds between Cys7-Cys57, Cys16-Cys40, and Cys32-Cys53)


APPLICATION of Dendrotoxin I

Dendrotoxin I (DTX-I) is a 60-residue peptide from the venom of the black mamba snake Dendroaspis polylepis, which binds to neuronal K+ channels.

  • APPLICATION of Dendrotoxin I
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.