Contact Us
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
Huwentoxin Iv






Product Name

huwentoxin IV


> 98%


Lyophilized powder


Soluble in water

Molecular weight

4107.20 Da

Molecular formula



Synthetic peptide


Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.


ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI (Disulfide bonds: Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31)

APPLICATION of Huwentoxin Iv

Huwentoxin-IV, a component of tarantula venom, potently blocks sodium channels and is an attractive scaffold for engineering a Nav1.7-selective molecule

  • APPLICATION of Huwentoxin Iv