Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
Huwentoxin Iv
Products

SPECIFICATION OF Huwentoxin Iv

CAT

N1020-V

CAS NO.

526224-73-7

Product Name

huwentoxin IV

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

4107.20 Da

Molecular formula

C174H277N51O52S6

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI (Disulfide bonds: Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31)



APPLICATION of Huwentoxin Iv

Huwentoxin-IV, a component of tarantula venom, potently blocks sodium channels and is an attractive scaffold for engineering a Nav1.7-selective molecule

  • APPLICATION of Huwentoxin Iv
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.