CAT | N1020-V |
CAS NO. | 526224-73-7 |
Product Name | huwentoxin IV |
Purity | > 98% |
Form/State | Lyophilized powder |
Solubility | Soluble in water |
Molecular weight | 4107.20 Da |
Molecular formula | C174H277N51O52S6 |
Source | Synthetic peptide |
Storage | Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions | Up to two weeks at 4°C or three months at -20°C. |
Sequence | ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI (Disulfide bonds: Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31) |
Huwentoxin-IV, a component of tarantula venom, potently blocks sodium channels and is an attractive scaffold for engineering a Nav1.7-selective molecule