Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
Iberiotoxin
Products

SPECIFICATION OF Iberiotoxin

CAT

K1060-V

CAS NO.

129203-60-7

Product Name

Iberiotoxin

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

4230.9 Da

Molecular formula

C179H276N50O56S7

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid)





APPLICATION of Iberiotoxin

Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel.

  • APPLICATION of Iberiotoxin
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.