Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
Kaliotoxin
Products

SPECIFICATION OF Kaliotoxin

CAT

K1070-V

CAS NO.

145199-73-1

Product Name

Kaliotoxin

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

4149.89 Da

Molecular formula

C171H283N55O49S6

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35)




APPLICATION of Kaliotoxin

Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system.

  • APPLICATION of Kaliotoxin
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.