Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
Mambalgin 1
Products

SPECIFICATION OF Mambalgin 1

CAT

O1010-V

CAS NO.

1609937-15-6

Product Name

Mambalgin-1

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

6554.5 Da

Molecular formula

C272H429N85O84S10

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38)


APPLICATION of Mambalgin 1

Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells.

  • APPLICATION of Mambalgin 1
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.