SEARCH
ENGLISH
CAT | O1010-V |
CAS NO. | 1609937-15-6 |
Product Name | Mambalgin-1 |
Purity | > 98% |
Form/State | Lyophilized powder |
Solubility | Soluble in water |
Molecular weight | 6554.5 Da |
Molecular formula | C272H429N85O84S10 |
Source | Synthetic peptide |
Storage | Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions | Up to two weeks at 4°C or three months at -20°C. |
Sequence | LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) |
Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells.
English 