Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
Margatoxin
Products

SPECIFICATION OF Margatoxin

CAT

K1020-V

CAS NO.

145808-47-5

Product Name

Margatoxin

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

4179.03 Da

Molecular formula

C178H286N52O50S7

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)




APPLICATION of Margatoxin

ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

  • APPLICATION of Margatoxin
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.