Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
Muscarinic Toxin 1
Products

SPECIFICATION OF Muscarinic Toxin 1

CAT

O1090-V

CAS NO.

/

Product Name

Muscarinic toxin 1

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

7509.5

Molecular formula

C326H499N87O101S8

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

LTCVTSKSIFGITTENCPDGQNLCFKKWYYIVPRYSDITWGCAATCPKPTNVRETIRCCETDKCNE (Disulfide bonds between Cys3-Cys24, Cys17-Cys42, Cys46-Cys58, and Cys59-Cys64)




APPLICATION of Muscarinic toxin 1

Muscarinic toxins (MTs) are natural toxins produced by mamba snakes that primarily bind to muscarinic acetylcholine receptors (MAChRs) and modulate their function.

  • APPLICATION of Muscarinic toxin 1
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.