SEARCH
ENGLISH
CAT | O1090-V |
CAS NO. | / |
Product Name | Muscarinic toxin 1 |
Purity | > 98% |
Form/State | Lyophilized powder |
Solubility | Soluble in water |
Molecular weight | 7509.5 |
Molecular formula | C326H499N87O101S8 |
Source | Synthetic peptide |
Storage | Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions | Up to two weeks at 4°C or three months at -20°C. |
Sequence | LTCVTSKSIFGITTENCPDGQNLCFKKWYYIVPRYSDITWGCAATCPKPTNVRETIRCCETDKCNE (Disulfide bonds between Cys3-Cys24, Cys17-Cys42, Cys46-Cys58, and Cys59-Cys64) |
Muscarinic toxins (MTs) are natural toxins produced by mamba snakes that primarily bind to muscarinic acetylcholine receptors (MAChRs) and modulate their function.
English 