Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
Protoxin II
Products

SPECIFICATION OF Protoxin II

CAT

N1030-V

CAS NO.

165168-50-3

Product Name

Protoxin II

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

4054.85 Da

Molecular formula

C169H274N54O48S7

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32)




APPLICATION of Protoxin II

Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.

  • APPLICATION of Protoxin II
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.