CAT | O1120-V |
CAS NO. | / |
Product Name | Psalmotoxin 1 |
Purity | > 98% |
Form/State | Lyophilized powder |
Solubility | Soluble in water |
Molecular weight | 4689.5 Da |
Molecular formula | C200H312N62O57S6 |
Source | Synthetic peptide |
Storage | Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions | Up to two weeks at 4°C or three months at -20°C. |
Sequence | EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33) |
Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).