Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
Psalmotoxin 1
Products

SPECIFICATION OF Psalmotoxin 1

CAT

O1120-V

CAS NO.

/

Product Name

Psalmotoxin 1

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

4689.5 Da

Molecular formula

C200H312N62O57S6

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT(Disulfide bonds between Cys3-Cys18, Cys10-Cys23, and Cys17-Cys33)





APPLICATION of Psalmotoxin 1

Psalmotoxin 1 (a component of the venom of a West Indies tarantula) is a 40-amino acid peptide that inhibits cation currents mediated by acid-sensing ion channels (ASIC).

  • APPLICATION of Psalmotoxin 1
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.