SEARCH
ENGLISH
CAT | K1010-V |
CAS NO. | 172450-46-3 |
Product Name | ShK Toxin |
Purity | > 98% |
Form/State | Lyophilized powder |
Solubility | Soluble in water |
Molecular weight | 4055 Da |
Molecular formula | C169H274N54O48S7 |
Source | Synthetic peptide |
Storage | Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions | Up to two weeks at 4°C or three months at -20°C. |
Sequence | RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds between Cys3-Cys35, Cys12-Cys28, and Cys17-Cys32) |
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.
English 