Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
ShK Toxin
Products

SPECIFICATION OF ShK Toxin

CAT

K1010-V

CAS NO.

172450-46-3

Product Name

ShK Toxin

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in water

Molecular weight

4055 Da

Molecular formula

C169H274N54O48S7

Source

Synthetic peptide

Storage

Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds between Cys3-Cys35, Cys12-Cys28, and Cys17-Cys32)



APPLICATION of ShK Toxin

ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

  • APPLICATION of ShK Toxin
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.