SEARCH
ENGLISH
CAT | C1080-V |
CAS NO. | 203460-30-4 |
Product Name | SNX482 (SNX 482, R-Type Ca2+ (Cav2.3) channel blocker) |
Purity | > 98% |
Form/State | Lyophilized powder |
Solubility | Soluble in 0.1% NH4OH |
Molecular weight | 4495.01 |
Molecular formula | C192H274N52O60S7 |
Source | Synthetic peptide |
Storage | Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
Storage of solutions | Up to two weeks at 4°C or three months at -20°C. |
Sequence | GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD (Modifications: Disulfide bonds: 7-21, 14-26, 20-33) |
SNX482 is a 41 amino acids peptide purified from the venom of an African tarantula, Hysterocrates gigas. SNX482 selectively blocks P/Q Ca2+ channels and delays the inactivation of Na+ channels of chromaffin cells
English 