Contact Us
ENGLISH
Hefei KS-V Peptide Biological Technology Co., Ltd. Hefei KS-V Peptide Biological Technology Co., Ltd.
Hefei KS-V Peptide Biological Technology Co., Ltd.
SNX482
Products

SPECIFICATION OF SNX482

CAT

C1080-V

CAS NO.

203460-30-4

Product Name

SNX482 (SNX 482, R-Type Ca2+ (Cav2.3) channel blocker)

Purity

> 98%

Form/State

Lyophilized powder

Solubility

Soluble in 0.1% NH4OH

Molecular weight

4495.01

Molecular formula

C192H274N52O60S7

Source

Synthetic peptide

Storage

Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions

Up to two weeks at 4°C or three months at -20°C.

Sequence

GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD (Modifications: Disulfide bonds: 7-21, 14-26, 20-33)







APPLICATION of SNX482

SNX482 is a 41 amino acids peptide purified from the venom of an African tarantula, Hysterocrates gigas. SNX482 selectively blocks P/Q Ca2+ channels and delays the inactivation of Na+ channels of chromaffin cells

  • APPLICATION of SNX482
KS-V PEPTIDE — PROVIDES THE BEST PEPTIDE SOLUTION.